PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN42174.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 360aa    MW: 40688.8 Da    PI: 6.9878
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN42174.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
       KHN42174.1 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLSRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding45.61.7e-1467112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E+  ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
       KHN42174.1  67 RGNFTPHEEGMIIHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-24564IPR009057Homeodomain-like
PROSITE profilePS5129426.054965IPR017930Myb domain
SuperFamilySSF466893.67E-3111108IPR009057Homeodomain-like
SMARTSM007174.9E-151363IPR001005SANT/Myb domain
PfamPF002492.2E-161461IPR001005SANT/Myb domain
CDDcd001671.03E-101661No hitNo description
Gene3DG3DSA:1.10.10.608.3E-2565117IPR009057Homeodomain-like
PROSITE profilePS5129418.7566116IPR017930Myb domain
SMARTSM007173.5E-1366114IPR001005SANT/Myb domain
PfamPF002496.5E-1367112IPR001005SANT/Myb domain
CDDcd001671.31E-869112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MGRPPCCDKV GIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGLSRCS KSCRLRWTNY  60
LRPGIKRGNF TPHEEGMIIH LQALLGNKWA AIASYLPQRT DNDIKNYWNT HLKKKLKKFQ  120
AALDPHSASD STASGQFLPK SFSDRRSTLD ISSNNNNNHG SSIRLSHHQS QSSSTTTYAS  180
STENISRLLE GWMRSSPKQL NKGSIISQYD EDHQLQGIND DDDNNNNNFV STTKLVNLHH  240
LHQHKIRNKD HEQEGGGVDN NMVSHHEEFD SILSFENQNN AAWDKSTCDS MPEKSSEASA  300
AADHHHHHHH DIAAAHERNN VRQKSENSSG APPLSFLEKW LLDENVGHQV EEMMELSPMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-23141164105MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-231211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1353151e-152BT135315.1 Lotus japonicus clone JCVI-FLLj-18D4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003520923.10.0PREDICTED: transcription factor MYB30-like
SwissprotQ9SCU73e-85MYB30_ARATH; Transcription factor MYB30
TrEMBLA0A0B2SD280.0A0A0B2SD28_GLYSO; Myb-related protein 306
TrEMBLI1JK530.0I1JK53_SOYBN; Uncharacterized protein
STRINGGLYMA03G00890.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82033145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.12e-86myb domain protein 60
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]